Scaffold Ga0100964_100100

Overview

Basic Information

• Taxon OID: 3300006517
• Scaffold ID: Ga0100964_100100
• Source Dataset Name: Sludge microbial communities from wastewater anaerobic digester in Oakland, CA, USA ? phosphite and CO2 enriched
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: QB3 Vincent J. Coates Genomics Sequencing Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1126
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → environmental samples → uncultured marine virus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Wastewater → Sludge Microbial Communities From Wastewater Anaerobic Digester In Oakland, Ca, Usa - Phosphite And Co2 Enriched

Source Dataset Sampling Location

• Location Name: Oakland, CA, USA
• Coordinates
  • Lat. (^o): 37.825917
  • Long. (^o): -122.295833

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011593	Metagenome / Metatranscriptome	289	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0100964_1001002	F011593	GAGG	MVTDNNLTAPPWCLGCPDPIYDDRRGEWDWYCRQHSPTGIRCSNVAVLRERCYRVREYFAKKEASK*