Basic Information | |
---|---|
Taxon OID | 3300006484 Open in IMG/M |
Scaffold ID | Ga0070744_10126212 Open in IMG/M |
Source Dataset Name | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 737 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Columbia River Estuary | |||||||
Coordinates | Lat. (o) | 46.234 | Long. (o) | -123.9135 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F008780 | Metagenome | 328 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0070744_101262122 | F008780 | N/A | MKKRHLVSLVTIIKDCLHAHSRANWDDKVVVETVSEVITKKFAKYIKDQEGLEKLGKTEEDFLAPPNGLNQ* |
⦗Top⦘ |