| Basic Information | |
|---|---|
| Taxon OID | 3300006481 Open in IMG/M |
| Scaffold ID | Ga0100229_1030590 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0025m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Hawaii |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2039 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 22.75 | Long. (o) | -158.0 | Alt. (m) | Depth (m) | 25 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011766 | Metagenome | 287 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0100229_10305901 | F011766 | N/A | SLGGTITGNVDISLPTDFCFYLVNTGTVTNINQFFPLFVASVDSSQQSYSLSEQKILPFINHPTVQAGANFGSANNALAPKQRGLMLKRGQALYVAASGATALTNGFYCNVQGGFY* |
| ⦗Top⦘ |