Scaffold Ga0100224_1177334

Overview

Basic Information

• Taxon OID: 3300006478
• Scaffold ID: Ga0100224_1177334
• Source Dataset Name: Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0125m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Hawaii
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1478
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Pelagophyceae → Pelagomonadales → Pelagomonas → Pelagomonas calceolata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 22.75
  • Long. (^o): -158.0
  • Depth (m): 125

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006402	Metagenome / Metatranscriptome	374	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0100224_11773341	F006402	GGTGG	MGSNETATATTGGPRVIDVFYGNGCHRAPNYLLFSDADRLADSLWDRSGVG*