Scaffold Ga0082251_10155762

Overview

Basic Information

• Taxon OID: 3300006468
• Scaffold ID: Ga0082251_10155762
• Source Dataset Name: Deep-sea sediment bacterial and archaeal communities from Fram Strait - Combined Assembly of Gp0119454, Gp0119453, Gp0119452, Gp0119451
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Center for Biotechnology (CeBiTec), Bielefeld Univeristy
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 937
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Bacterial And Archaeal Communities

Source Dataset Sampling Location

• Location Name: Fram Strait
• Coordinates
  • Lat. (^o): 77.978277
  • Long. (^o): 0.163645
  • Depth (m): 3500

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071263	Metagenome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082251_101557621	F071263	N/A	RDLCDLARDVNESLESLIRFGAIGELTIYVIADDWPVRSSDETEDTVNGPVFLLDKDLHQSLNAEVTKVSQVRRPEDDEFVTLDEPVEVARGVHFVSAEEAERFSREHALTLKSSSDTPSYLNRNHDFYSTELATAVKAWMALFADGSFEPGGKTSRQRIELWLTAQRLGLKENAEQRIASVVNPDTKKGGGSPRTPTKYTPTHRFLSDSST*