| Basic Information | |
|---|---|
| Taxon OID | 3300006468 Open in IMG/M |
| Scaffold ID | Ga0082251_10060821 Open in IMG/M |
| Source Dataset Name | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Combined Assembly of Gp0119454, Gp0119453, Gp0119452, Gp0119451 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Center for Biotechnology (CeBiTec), Bielefeld Univeristy |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1423 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfocapsaceae → Desulfotalea → unclassified Desulfotalea → Desulfotalea sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Bacterial And Archaeal Communities |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Fram Strait | |||||||
| Coordinates | Lat. (o) | 77.978277 | Long. (o) | 0.163645 | Alt. (m) | Depth (m) | 3500 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042344 | Metagenome | 158 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0082251_100608214 | F042344 | N/A | MKRLFKTGIVTTLMGLTILSIAICLYISKHHNETEAGAVAALGLLLLRSNDSLIGLTKK* |
| ⦗Top⦘ |