| Basic Information | |
|---|---|
| Taxon OID | 3300006467 Open in IMG/M |
| Scaffold ID | Ga0099972_11387726 Open in IMG/M |
| Source Dataset Name | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | JGI facility at Oak Ridge National Laboratory, Brown University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1132 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Sediment → Marine → Coastal Sediment Microbial Communities From Rhode Island, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Rhode Island | |||||||
| Coordinates | Lat. (o) | 40.435 | Long. (o) | -70.483 | Alt. (m) | Depth (m) | 78 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053305 | Metagenome / Metatranscriptome | 141 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0099972_113877262 | F053305 | N/A | MLKKSLSMVLVGLFVFSFIAVATLSADETQKITGTVMSINVETGEVIVKDAAGEMKSLMADPKAGMDLKGLKEGDLVNAESDSNGIIKSLEVSK* |
| ⦗Top⦘ |