Scaffold Ga0082250_10000677

Overview

Basic Information

• Taxon OID: 3300006465
• Scaffold ID: Ga0082250_10000677
• Source Dataset Name: Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten IX
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Center for Biotechnology (CeBiTec), Bielefeld Univeristy
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6298
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 10 (90.91%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Aestuariibacter → Aestuariibacter halophilus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Bacterial And Archaeal Communities

Source Dataset Sampling Location

• Location Name: Fram Strait
• Coordinates
  • Lat. (^o): 77.950787
  • Long. (^o): -1.627126
  • Depth (m): 5500

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084258	Metagenome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082250_100006777	F084258	AGGCGG	MRSETELKNQIQKAQRADQLLNDPLIQEFIISVRGDLLNTFESTTLKSEAERAAAWNQSQVFNLFMSKFTKTIKEGKDARTMLEQAKHTLRNII*