| Basic Information | |
|---|---|
| Taxon OID | 3300006447 Open in IMG/M |
| Scaffold ID | Ga0100194_101728 Open in IMG/M |
| Source Dataset Name | Microbial communities from pig manure storage tank from Sherbrooke, QC, Canada, enriched culture A4 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Agriculture and Agri-Food Canada |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 785 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Solid Waste → Animal Waste → Unclassified → Unclassified → Manure → Microbial Communities From Manure Storage Tank From Sherbrooke, Qc, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sherbrooke, QC, Canada | |||||||
| Coordinates | Lat. (o) | 45.4 | Long. (o) | -71.9 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043951 | Metagenome / Metatranscriptome | 155 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0100194_1017283 | F043951 | GAGG | MEHLSLGRPIEASLGPRYQCPVCGQKLWTIQAPWTGWQEWYKTEDGRRHYKHSCNIMRDAHIAFRRMFGQDW* |
| ⦗Top⦘ |