Basic Information | |
---|---|
Taxon OID | 3300006421 Open in IMG/M |
Scaffold ID | Ga0082247_12103922 Open in IMG/M |
Source Dataset Name | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten I |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Center for Biotechnology (CeBiTec), Bielefeld Univeristy |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 512 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Bacterial And Archaeal Communities |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Fram Strait | |||||||
Coordinates | Lat. (o) | 78.153207 | Long. (o) | 5.975413 | Alt. (m) | Depth (m) | 1200 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F066842 | Metagenome | 126 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0082247_121039222 | F066842 | GGAG | VNIFEQGLWKIINEASPTGTSGYGSGITTGDAWPDGLYTKRGERRYVGPVSLTRGMQQVDFPAADNIYGGPDSQNNERRAKRDAGKLYKYLSDPDGNSEVKANELRDDTPPLSPKQRMYGIHGFHRK |
⦗Top⦘ |