Basic Information | |
---|---|
Taxon OID | 3300006420 Open in IMG/M |
Scaffold ID | Ga0082248_12632336 Open in IMG/M |
Source Dataset Name | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten IV |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Center for Biotechnology (CeBiTec), Bielefeld Univeristy |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 503 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Deep-Sea Sediment Bacterial And Archaeal Communities |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Fram Strait | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | 2500 | Location on Map | ||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F090490 | Metagenome | 108 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0082248_126323361 | F090490 | N/A | MAHLITVTNLNEHELLFNLDTVVSMERGSNGNTIVTTRWSRTDIKETLEEVKNLAQKSSLEY |
⦗Top⦘ |