Scaffold Ga0082248_12632336

Overview

Basic Information

• Taxon OID: 3300006420
• Scaffold ID: Ga0082248_12632336
• Source Dataset Name: Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten IV
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Center for Biotechnology (CeBiTec), Bielefeld Univeristy
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 503
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Deep-Sea Sediment Bacterial And Archaeal Communities

Source Dataset Sampling Location

• Location Name: Fram Strait
• Coordinates
  • Depth (m): 2500

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090490	Metagenome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082248_126323361	F090490	N/A	MAHLITVTNLNEHELLFNLDTVVSMERGSNGNTIVTTRWSRTDIKETLEEVKNLAQKSSLEY