NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0082248_10457885

Scaffold Ga0082248_10457885


Overview

Basic Information
Taxon OID3300006420 Open in IMG/M
Scaffold IDGa0082248_10457885 Open in IMG/M
Source Dataset NameDeep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten IV
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCenter for Biotechnology (CeBiTec), Bielefeld Univeristy
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)554
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Deep-Sea Sediment Bacterial And Archaeal Communities

Source Dataset Sampling Location
Location NameFram Strait
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)2500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F103884Metagenome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0082248_104578852F103884AGGLIVTATTNLTDIKAVLCNPAIYDTIADDNCPNIEDFEPPINDEYLYVGGYVDNEIIGLMVYHEYLDGNKCHVQVLPENRKEHAKQFGEQSLQYRGTRPLYAEIPDLYKNVLDFAILNDFKVIKRIDNGFIKDGVNYTVNVLRYK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.