| Basic Information | |
|---|---|
| Taxon OID | 3300006420 Open in IMG/M |
| Scaffold ID | Ga0082248_10009147 Open in IMG/M |
| Source Dataset Name | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten IV |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Center for Biotechnology (CeBiTec), Bielefeld Univeristy |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1650 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Deep-Sea Sediment Bacterial And Archaeal Communities |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Fram Strait | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | 2500 | Location on Map | ||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032288 | Metagenome / Metatranscriptome | 180 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0082248_100091473 | F032288 | GAGG | MTIKYLATALAMTIGLLFTVSTAHAAQPLDVDCDLLADTNDDVNIFLDTMTNIQFDNLGDLVSSAILDDAVFAQLSALVTLFSGGAINFDSASQAVSTNAACGLIPQLIGNVND* |
| ⦗Top⦘ |