Scaffold Ga0082248_10000006

Overview

Basic Information

• Taxon OID: 3300006420
• Scaffold ID: Ga0082248_10000006
• Source Dataset Name: Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten IV
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Center for Biotechnology (CeBiTec), Bielefeld Univeristy
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 33282
• Total Scaffold Genes: 47
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 16 (34.04%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Deep-Sea Sediment Bacterial And Archaeal Communities

Source Dataset Sampling Location

• Location Name: Fram Strait
• Coordinates
  • Depth (m): 2500

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082716	Metagenome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082248_1000000646	F082716	GGAG	MINKKDLRQMPFTFIIAPILLVALTSVVAITYGEMIEEKELIVTLSCPDLKKYTENQFIESKLYFGHDVYLNYAKELYRDFC*