| Basic Information | |
|---|---|
| Taxon OID | 3300006417 Open in IMG/M |
| Scaffold ID | Ga0069787_10737356 Open in IMG/M |
| Source Dataset Name | Combined Assembly of Gp0110018, Gp0110022, Gp0110020 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Australian Centre for Ecogenomics, Aalborg University, University of Queensland |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1409 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor → Enhanced Biological Phosphorus Removal Bioreactor Microbial Communities From The University Of Queensland, Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Thorneside, Queensland, Australia | |||||||
| Coordinates | Lat. (o) | -27.485973 | Long. (o) | 153.190699 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008147 | Metagenome / Metatranscriptome | 338 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0069787_107373562 | F008147 | AGG | MSIEEAILEKVRRLPPAKQEEVLRFADGLQHRSAVRKVPSRDRRREIEWLKENRAKYLDQWVVVEGDRLVAADADGVNAYDAAIAAGIEVPFLIHVLPEDPLPFVPAWL* |
| ⦗Top⦘ |