Scaffold Ga0099654_10440032

Overview

Basic Information

• Taxon OID: 3300006415
• Scaffold ID: Ga0099654_10440032
• Source Dataset Name: Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake community
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Institut Pasteur, Lille, France
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 830
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake → Algae And Fungi Communities From Freshwater Lake In Auvergne, France During And After Algae Bloom

Source Dataset Sampling Location

• Location Name: Auvergne, France
• Coordinates
  • Lat. (^o): 45.49
  • Long. (^o): 2.88

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034578	Metagenome / Metatranscriptome	174	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0099654_104400321	F034578	N/A	SSDLAECEPPPAALLDKLAYEIIKEEQRLKGAQVDGKGPLFSTILCHLLYSLAVMVPLHAKVAANSASVRGAAFAQLMKVQTMVASSVQPPSLYDQGDGKRAKLFLYVRATACIRAALQIITGSWPQADFGPRFAIGEEGGRDFIQYCTKHINQVYNNKTALTRVLGTPWERLMLSQGPTLTIAELLLTVCSTDGSLKDVSRLGGEQALHSLSRYGESAQIRQQATMLLTKLAVMQA*