Scaffold Ga0099655_124875

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0099655_124875

Scaffold Ga0099655_124875

Overview

Basic Information
Taxon OID	3300006408 Open in IMG/M
Scaffold ID	Ga0099655_124875 Open in IMG/M
Source Dataset Name	Algae and Fungi communities from freshwater lake in Auvergne, France - collected at the beginning of algae bloom, incubated in lab for 1 day
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Institut Pasteur, Lille, France
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1427
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake → Algae And Fungi Communities From Freshwater Lake In Auvergne, France During And After Algae Bloom

Source Dataset Sampling Location
Location Name	Auvergne, France
Coordinates	Lat. (^o)	45.49	Long. (^o)	2.88	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092089	Metagenome / Metatranscriptome	107	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0099655_1248751	F092089	N/A	MLLVSQEMKLLSSIGILLALSISFAFAGKSTFKKFPGGLDKKNYVPSNIGKRILKGNSRKGSIVKKSKKKGARASTDSAPTVVQSYMNWAVCLHDRTSNKACLPQLGVPKGYYFLDPFVVYSSCSNTTIPVRKCNVPVDPKGEHLTVVIPVAPDVWIDYDDDPKGRICNESRPTGNDPLLLYLKTNVVTEHLKYTQLPYAFVNGRSLSMEYIIEDEPFYLKSCSNKVQCCDEGCDFPSCEDCGGVDAYPIIGYIATDTSRWKPGEKRYYQWGYGIDDDACGCSGCSMGRVELTAVEK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.