NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079066_1027469

Scaffold Ga0079066_1027469


Overview

Basic Information
Taxon OID3300006395 Open in IMG/M
Scaffold IDGa0079066_1027469 Open in IMG/M
Source Dataset NameActive sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Cas_02_SludgeMetaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6323
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (85.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUrbana, Illinois, USA
CoordinatesLat. (o)40.1191Long. (o)-88.1952Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F085739Metagenome / Metatranscriptome111N

Sequences

Protein IDFamilyRBSSequence
Ga0079066_10274691F085739GAGGMSGILSGGPTSCANCVQTDCSHSTDLPDLALICEAFVNATFPPDVQDDIKNGNRCHICGAPAILGGGERVTCGDCLFRQNAARGRLGDKAIREWRGTAAEPPAPVLDAGADPDEVEEEEEA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.