Scaffold Ga0075507_1109079

Overview

Basic Information

• Taxon OID: 3300006392
• Scaffold ID: Ga0075507_1109079
• Source Dataset Name: Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 638
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location

• Location Name: USA: Delaware
• Coordinates
  • Lat. (^o): 39.283
  • Long. (^o): -75.3633

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022908	Metagenome / Metatranscriptome	212	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0075507_11090791	F022908	N/A	ILSADSKLRDKTPRIYAMPKDEHMPKAFTNLKRMRYLSHDVCAGRNIKRWLWRDYHPEIILQQPPFDQYEDQSEIFTLIRHPEERWWSGIKDMFYFMPWYGWWANDKIMEQWPHFGRGTLRYHDIMQDIKPQHLIKCDAGLNDRMINFAKTHGLLCYGNIPHEKALRHSKPEIKSLEDKGVRELKAWLRENPDRQKQLDEYLAPDWQYWEKV