NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068659_1127449

Scaffold Ga0068659_1127449


Overview

Basic Information
Taxon OID3300006363 Open in IMG/M
Scaffold IDGa0068659_1127449 Open in IMG/M
Source Dataset NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0600_B MetaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1122
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.539Long. (o)-110.798Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002229Metagenome / Metatranscriptome580Y
F002372Metagenome / Metatranscriptome566Y
F002795Metagenome / Metatranscriptome529Y

Sequences

Protein IDFamilyRBSSequence
Ga0068659_11274492F002372AGGGGGMPTRREDALWQIVHRKSSHLRALLDSLDLVDVGVTYELDFYPYAIVELLRVREDAPPIVLRSAYVSANRQWERHSEFTLRVVEAALQLVHEYRADPSAGGSDSWA*
Ga0068659_11274493F002795AGGAGGMVTNSGLILRGMVASYREFISRKDGKTYRVATVFGDLMAGETVLCQVDGYDVFVDSSYARGEMVELPARMQFLRDGSGRPVIKLYVDEGVR*
Ga0068659_11274494F002229N/AVTLLTLDGVEDVDYVPSDAEVRASLDDAGLYGMVLNGVTWMRLSSGAGWWTVIGGRRVTATLAAIGWCWVADGLGARGYWSPALACIPGEVRALCGGCAEDEDEEAGDGDE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.