Basic Information | |
---|---|
Taxon OID | 3300006360 Open in IMG/M |
Scaffold ID | Ga0079079_1036579 Open in IMG/M |
Source Dataset Name | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Val_03_SludgeMetaT (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 547 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin009 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Illinois, USA | |||||||
Coordinates | Lat. (o) | 40.1191 | Long. (o) | -88.1952 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F018746 | Metagenome / Metatranscriptome | 233 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0079079_10365791 | F018746 | GGAG | MRQSEALNAFEQAVIQAIERNPDHTIVIADLLREFSPRAPRSSCVARLEQMERRGLIAMSRFAGRILIHPPVEE* |
⦗Top⦘ |