NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068871_102351091

Scaffold Ga0068871_102351091


Overview

Basic Information
Taxon OID3300006358 Open in IMG/M
Scaffold IDGa0068871_102351091 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)508
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: South Gull Lake, Michigan
CoordinatesLat. (o)42.405765Long. (o)-85.399014Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073686Metagenome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0068871_1023510911F073686N/AAEAPGGNTGGITFDLGMTVTLLPKLTVGVVGTNLRDLHNSNATQGVGYGIAVAPIPDLVIAADGYTSLTRDNYTNRKGTGFMVGGDLTLGGKFSLRAGGGYDPATANGYGALGLSAVSEIGAIDGSIRQDLLVHEGSPRATIALISLRLFIPAQQPSLQPPGTL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.