NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0099954_1328477

Scaffold Ga0099954_1328477


Overview

Basic Information
Taxon OID3300006350 Open in IMG/M
Scaffold IDGa0099954_1328477 Open in IMG/M
Source Dataset NameMarine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hawaii
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1419
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)22.75Long. (o)-158.0Alt. (m)Depth (m)75
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005670Metagenome / Metatranscriptome393Y
F023880Metagenome / Metatranscriptome208Y

Sequences

Protein IDFamilyRBSSequence
Ga0099954_13284772F023880N/AMKTDHTYAAQIELTNVPEDTLKQWTNMPPISEELYQELVKEFNNERLYFFNDSYTLED*
Ga0099954_13284773F005670N/AMQLLSRREYNLILRSLDKYELYMNSKEKQLSEDLQDKLYYNLYNPKDGIAQTEVELPDLDINLSALYDIQTEKDLSI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.