Scaffold Ga0099693_1295154

Overview

Basic Information

• Taxon OID: 3300006345
• Scaffold ID: Ga0099693_1295154
• Source Dataset Name: Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Hawaii
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 777
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 22.75
  • Long. (^o): -158.0
  • Depth (m): 75

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084358	Metagenome	112	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0099693_12951544	F084358	GGAG	MTLIDFDKKELLDISHALLSYRTDSTVIRKGGLTDEQKERYKRLTSLIEKVSQLRNVCDCGGKTN*