NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068503_10081772

Scaffold Ga0068503_10081772


Overview

Basic Information
Taxon OID3300006340 Open in IMG/M
Scaffold IDGa0068503_10081772 Open in IMG/M
Source Dataset NameMarine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hawaii
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1441
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)22.75Long. (o)-158.0Alt. (m)Depth (m)770
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F081441Metagenome / Metatranscriptome114N

Sequences

Protein IDFamilyRBSSequence
Ga0068503_100817725F081441AGGAMVLSSREKFIAFYSMFLTTHIGLGVNPGELDKDGMGHIFNSVLETVRKSTCPDISEDETKAIAEDFNIEMFKIRTILDEALRSQRLGDRV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.