NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068481_1152539

Scaffold Ga0068481_1152539


Overview

Basic Information
Taxon OID3300006339 Open in IMG/M
Scaffold IDGa0068481_1152539 Open in IMG/M
Source Dataset NameMarine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hawaii
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)880
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)22.75Long. (o)-158.0Alt. (m)Depth (m)500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010477Metagenome / Metatranscriptome303Y
F026028Metagenome / Metatranscriptome199Y

Sequences

Protein IDFamilyRBSSequence
Ga0068481_11525393F026028GAGMSVCSNCYHRIKHKKAIEVGQLWNNEPFLGVVCSDKCKEEIEKKVADGTWMVMRSFPKITEEEDGLPTALTDKQFGVE*
Ga0068481_11525394F010477N/AMKIHLQIRYLVFIPYLIFIGIMGGNILAESIVVGLA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.