Basic Information | |
---|---|
Taxon OID | 3300006338 Open in IMG/M |
Scaffold ID | Ga0068482_1803369 Open in IMG/M |
Source Dataset Name | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Hawaii |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 619 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean | |||||||
Coordinates | Lat. (o) | 22.75 | Long. (o) | -158.0 | Alt. (m) | Depth (m) | 770 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F019024 | Metagenome | 232 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0068482_18033692 | F019024 | AGGAGG | MKLYKLEASNWETFFGTTDNRIERDVITLAQTPSCDAFLYLSNETYDQLELLDSVPLGFDFTYCQEWGLTI |
⦗Top⦘ |