Scaffold Ga0068486_1028873

Overview

Basic Information

• Taxon OID: 3300006329
• Scaffold ID: Ga0068486_1028873
• Source Dataset Name: Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0500m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Hawaii
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2328
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 22.75
  • Long. (^o): -158.0
  • Depth (m): 500

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008851	Metagenome / Metatranscriptome	327	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068486_10288732	F008851	AGTAGG	MKKFKVIENYSTTEGTLYKGEVLREDDNNTLDGHKRLKDSMGRVWFIPFKYIVRI*