NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068476_1086310

Scaffold Ga0068476_1086310


Overview

Basic Information
Taxon OID3300006324 Open in IMG/M
Scaffold IDGa0068476_1086310 Open in IMG/M
Source Dataset NameMarine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0500m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hawaii
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1420
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station

Source Dataset Sampling Location
Location NamePacific Ocean: North Pacific Ocean
CoordinatesLat. (o)22.75Long. (o)-158.0Alt. (m)Depth (m)500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047308Metagenome / Metatranscriptome150N
F066859Metagenome / Metatranscriptome126N

Sequences

Protein IDFamilyRBSSequence
Ga0068476_10863101F047308N/APPSRAEATLTATYAAVTNADETEVSITSEYLDGIPRNEALYYSEFSKNTDGVDSSSFGNWTQTTNLVGNMTGMLFNSPTIPGGSTLMEDGTIQQVRIQGNGNTLLVYEWSEIQNPGIFNGQMFNALEESPATTGILDNYRWLSLAKEPIPAGTRVQTDIMAGVDSETIRTVQVQQVPFRGR*
Ga0068476_10863102F066859GGAMVHELPDNNGRVQTQINTSRAGYYVSNFDTAESVTLTPQGGGTIDIVLPPGAKVAIPDKIGMVAQGGNSSRNYIFLMWTAGYAN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.