| Basic Information | |
|---|---|
| Taxon OID | 3300006314 Open in IMG/M |
| Scaffold ID | Ga0099587_10147193 Open in IMG/M |
| Source Dataset Name | Prairie soil microbial communities from Kansas, USA, after rainfall - K01 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 552 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Grasslands → Prairie Soil → Prairie Soil Microbial Communities From Kansas, Usa, After Rainfall |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Konza Prairie, Kansas, USA | |||||||
| Coordinates | Lat. (o) | 39.1038 | Long. (o) | -96.6133 | Alt. (m) | Depth (m) | .2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026344 | Metagenome / Metatranscriptome | 198 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0099587_101471931 | F026344 | N/A | IIGQRVVKLLMATTTKAKFLVSLATTPDHSSHRLTFDGRGVYSGFSLACFLPPRTVMIDLHPTAVGQHARLLYAACKAMPNVVERRDFRWDR* |
| ⦗Top⦘ |