Scaffold Ga0099601_10077637

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0099601_10077637

Scaffold Ga0099601_10077637

Overview

Basic Information
Taxon OID	3300006283 Open in IMG/M
Scaffold ID	Ga0099601_10077637 Open in IMG/M
Source Dataset Name	Prairie soil microbial communities from Kansas, USA, after rainfall - K15
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Oregon State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	671
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Prairie Soil → Prairie Soil Microbial Communities From Kansas, Usa, After Rainfall

Source Dataset Sampling Location
Location Name	Konza Prairie, Kansas, USA
Coordinates	Lat. (^o)	39.1038	Long. (^o)	-96.6133	Alt. (m)		Depth (m)	.2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027947	Metagenome / Metatranscriptome	193	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0099601_100776372	F027947	AGG	MLKFDASIFGGELPVGLGVVGIAVMLPGGDFVDEDLFVGNAAVEALGR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.