NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0099518_100004

Scaffold Ga0099518_100004


Overview

Basic Information
Taxon OID3300006260 Open in IMG/M
Scaffold IDGa0099518_100004 Open in IMG/M
Source Dataset NameHuman tongue dorsum microbial communities from NIH, USA - visit 1, subject 159915365
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)252749
Total Scaffold Genes318 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)266 (83.65%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054109Metagenome140N

Sequences

Protein IDFamilyRBSSequence
Ga0099518_100004177F054109AGGAGMTGRPKSKKGVKVHTAFKIYPKDKERAQIMADKLDMSLSAYINKAVLEKLTHDEKSEA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.