Scaffold Ga0097621_100368281

Overview

Basic Information

• Taxon OID: 3300006237
• Scaffold ID: Ga0097621_100368281
• Source Dataset Name: Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1281
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location

• Location Name: USA: South Gull Lake, Michigan
• Coordinates
  • Lat. (^o): 42.405765
  • Long. (^o): -85.399014

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026668	Metagenome	197	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0097621_1003682814	F026668	GGAGG	MALIKLNCMYGHLEGIEPKVAREVTGYLSIDAGIYAKHGLEVSWNHVQGTEERYRRLGSGEAQISFVVGRASLQ