Scaffold Ga0097621_100005110

Overview

Basic Information

• Taxon OID: 3300006237
• Scaffold ID: Ga0097621_100005110
• Source Dataset Name: Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 9216
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (54.55%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location

• Location Name: USA: South Gull Lake, Michigan
• Coordinates
  • Lat. (^o): 42.405765
  • Long. (^o): -85.399014

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059382	Metagenome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0097621_1000051105	F059382	GAGG	MKTEDPEVILLELKYCERCGALWLRLRGAQDIYCAPCDLEMLDLPSPRSAPSRPRLPGNHKVDVREQPDGLSTFYGEEGTA*