NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0082389_123812

Scaffold Ga0082389_123812


Overview

Basic Information
Taxon OID3300006229 Open in IMG/M
Scaffold IDGa0082389_123812 Open in IMG/M
Source Dataset NameMarine sediment microbial communities, 0.9 km from oil contamination, elevated hydrocarbon, Gulf of Mexico ? BC143
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterYale Center for Genome Analysis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)685
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico

Source Dataset Sampling Location
Location NameGulf of Mexico
CoordinatesLat. (o)28.3Long. (o)-88.2Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018020Metagenome / Metatranscriptome237Y

Sequences

Protein IDFamilyRBSSequence
Ga0082389_1238121F018020N/AVSDTLGDGTTENVSIILSGYSSLTFEINNVPIPDPVPPPKEWVI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.