Scaffold Ga0082389_123812

Overview

Basic Information

• Taxon OID: 3300006229
• Scaffold ID: Ga0082389_123812
• Source Dataset Name: Marine sediment microbial communities, 0.9 km from oil contamination, elevated hydrocarbon, Gulf of Mexico ? BC143
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Yale Center for Genome Analysis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 685
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Sediment Microbial Communities From Different Distances From Oil Contamination, Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Gulf of Mexico
• Coordinates
  • Lat. (^o): 28.3
  • Long. (^o): -88.2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018020	Metagenome / Metatranscriptome	237	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082389_1238121	F018020	N/A	VSDTLGDGTTENVSIILSGYSSLTFEINNVPIPDPVPPPKEWVI*