| Basic Information | |
|---|---|
| Taxon OID | 3300006226 Open in IMG/M |
| Scaffold ID | Ga0099364_10295249 Open in IMG/M |
| Source Dataset Name | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1763 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pointe-Noire, Republic of the Congo | |||||||
| Coordinates | Lat. (o) | -4.7 | Long. (o) | 11.83 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002326 | Metagenome | 570 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0099364_102952495 | F002326 | N/A | QLVLLDSCLQTCMAYTSAERTVNKLLMMSRGTARNM* |
| ⦗Top⦘ |