Basic Information | |
---|---|
Taxon OID | 3300006226 Open in IMG/M |
Scaffold ID | Ga0099364_10172245 Open in IMG/M |
Source Dataset Name | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2424 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pointe-Noire, Republic of the Congo | |||||||
Coordinates | Lat. (o) | -4.7 | Long. (o) | 11.83 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F030795 | Metagenome | 184 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0099364_101722451 | F030795 | AGGA | MFPNEEGQKHLVRNTKGQWVSKEKDGYRSEIEEESCEVA* |
⦗Top⦘ |