Scaffold Ga0082206_105705

Overview

Basic Information

• Taxon OID: 3300006225
• Scaffold ID: Ga0082206_105705
• Source Dataset Name: Biogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 99 accuracy
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Norwegian Sequencing Centre (NSC)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 781
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Mixed Substrate Biogas Reactor → Biogas Reactor Microbial Communities From Swedish University Of Agricultural Sciences, Alnarp, Sweden, And As, Norway That Are Enriched On Cellulose

Source Dataset Sampling Location

• Location Name: Alnarp, Sweden
• Coordinates
  • Lat. (^o): 59.8152338
  • Long. (^o): 17.6620518

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097599	Metagenome / Metatranscriptome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0082206_1057051	F097599	N/A	LTEFENLKKELETAKAQTAELVNLKQELETLKAEKATAEKDTKWNAMKANLPEGWLGAKEPETRKEFEADPGAFALKVVAFKNTQPQEQQAEGTGATGGSGDAESTEEQKFANMAAEVAKATGIQFV*