Basic Information | |
---|---|
Taxon OID | 3300006225 Open in IMG/M |
Scaffold ID | Ga0082206_102096 Open in IMG/M |
Source Dataset Name | Biogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 99 accuracy |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Norwegian Sequencing Centre (NSC) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 15224 |
Total Scaffold Genes | 32 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 19 (59.38%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Mixed Substrate Biogas Reactor → Biogas Reactor Microbial Communities From Swedish University Of Agricultural Sciences, Alnarp, Sweden, And As, Norway That Are Enriched On Cellulose |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Alnarp, Sweden | |||||||
Coordinates | Lat. (o) | 59.8152338 | Long. (o) | 17.6620518 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F053364 | Metagenome / Metatranscriptome | 141 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0082206_10209611 | F053364 | N/A | MLSIRAGVLVAKGGDRVSDPLNDILVECCKLRGCYPLMHRTLHEFNWFCSCVIWGAGPFIDGEIATAEADGDEALAGVLKDRRNEENGIRDRFGEWYSHGSDELIRLAEAFRIYCREQYGDEEVGA* |
⦗Top⦘ |