| Basic Information | |
|---|---|
| Taxon OID | 3300006224 Open in IMG/M |
| Scaffold ID | Ga0079037_100468516 Open in IMG/M |
| Source Dataset Name | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1204 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands → Freshwater Wetland Microbial Communities From Ohio, Usa, Analyzing The Effect Of Biotic And Abiotic Controls |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Ohio, Lake Erie, Old Woman Creek | |||||||
| Coordinates | Lat. (o) | 41.384 | Long. (o) | -82.513 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F062886 | Metagenome | 130 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0079037_1004685161 | F062886 | GGAGG | MARRRLMCVAIAVSAGLSGSAAAQPTAAGIVARSVQAHGGDALTSWQTLKITGTVVMQDGIAYTGAYTLLAKAPDRLRIEHDATADRGRAFYDYFLNGGVAWSRRNLIPGTLEVDRIRRWMDHCYGIAFYAKPDVTLERLPDADLAWPPQATGSATPPAAVAARRVWVVAAMVGDERREVFIDQETARFLQEVTPQSTRVYWDFKTFDGMLVPGRILEITRTRQGESRTPFTWSDVKRNVPIEDWRFAEDMPKK* |
| ⦗Top⦘ |