Scaffold Ga0075366_10293194

Overview

Basic Information

• Taxon OID: 3300006195
• Scaffold ID: Ga0075366_10293194
• Source Dataset Name: Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 995
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location

• Location Name: USA: Tennessee
• Coordinates
  • Lat. (^o): 35.8444
  • Long. (^o): -83.9599
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071395	Metagenome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0075366_102931942	F071395	N/A	IDLTSYIKLYQFVPVDQKREVTINAKDGLLNDKDDARGKLINFSVKMISPDNYMIQLPDQLDAGEYGFVWVKNMELKEFVVYAFGIDWKSID*