NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075447_10201282

Scaffold Ga0075447_10201282


Overview

Basic Information
Taxon OID3300006191 Open in IMG/M
Scaffold IDGa0075447_10201282 Open in IMG/M
Source Dataset NameMarine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)654
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The West Antarctic Peninsula, For Metatranscriptomic Analysis

Source Dataset Sampling Location
Location NameAtlantic Ocean: West Antarctic Peninsula
CoordinatesLat. (o)-64.8156Long. (o)-64.0406Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049234Metagenome147N

Sequences

Protein IDFamilyRBSSequence
Ga0075447_102012822F049234N/AMARIELELTAIVYENSEFACEEYKIVAFVSDWNDGEKVTEAAEKAVNDHMKHSKKLCIGGCAKVFVNKEKIADAIFQNPDADEGLFDKAAELFGLEEGTVH*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.