| Basic Information | |
|---|---|
| Taxon OID | 3300006188 Open in IMG/M |
| Scaffold ID | Ga0097683_1196337 Open in IMG/M |
| Source Dataset Name | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_cont_1000_plan - 1398105538256 (version 2) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 511 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South Africa: Cape Town | |||||||
| Coordinates | Lat. (o) | -33.927 | Long. (o) | 18.452665 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001866 | Metagenome | 624 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0097683_11963372 | F001866 | N/A | EPVSDDDSALIIDAQSVRAIELAWLIAVRAELEQERAIDRRQYLHSMIVGIDDDDSMSIIVDRQTVMILELARSRSFVTDREQERVIDRRQEHQSIVVGISNDDAMMMLVDRDAARIVELEVS* |
| ⦗Top⦘ |