NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0097683_1049704

Scaffold Ga0097683_1049704


Overview

Basic Information
Taxon OID3300006188 Open in IMG/M
Scaffold IDGa0097683_1049704 Open in IMG/M
Source Dataset NameWastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_cont_1000_plan - 1398105538256 (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1692
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Source Dataset Sampling Location
Location NameSouth Africa: Cape Town
CoordinatesLat. (o)-33.927Long. (o)18.452665Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001866Metagenome624Y

Sequences

Protein IDFamilyRBSSequence
Ga0097683_10497042F001866N/AMILELAWLIAVRAELEQERAIDRRQYLHSIIVGITDDDSMSIIVDRNARWAMELARLRSSRADGEQEREIDRRQEHQSIVVGIGDDDAMMMLVDRNASGILEHAFESSPPSLDHTP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.