Scaffold Ga0075369_10361251

Overview

Basic Information

• Taxon OID: 3300006186
• Scaffold ID: Ga0075369_10361251
• Source Dataset Name: Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 682
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location

• Location Name: USA: Tennessee
• Coordinates
  • Lat. (^o): 35.8444
  • Long. (^o): -83.9599
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003967	Metagenome	459	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0075369_103612511	F003967	N/A	LRDFWYEAQKKAKKTARDRGFQGWNDVAVWRDFKPIYIPEDIWPHYLEHVTSERFTRRSQSGAGNRNRPIHGEVTTHTSSSVPFAAHAK