Scaffold Ga0070765_100829248

Overview

Basic Information

• Taxon OID: 3300006176
• Scaffold ID: Ga0070765_100829248
• Source Dataset Name: Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 874
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From The Hubbard Brook Experimental Forest, New Hampshire, Under Manipulated Climate Change Conditions.

Source Dataset Sampling Location

• Location Name: USA: New Hampshire, Hubbard Brook experimental Forest
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056769	Metagenome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0070765_1008292482	F056769	GGAGG	MRWRQSFIAEVSQALQQLGLRACPICGSADALGIGRFPAFWLEGGPPLDCDDLPVGEDHDYHLTFAVRIECSACGHLMLFNAQKYRTGDEQILVRERAEEEGQLRE*