Scaffold Ga0075018_10745988

Overview

Basic Information

• Taxon OID: 3300006172
• Scaffold ID: Ga0075018_10745988
• Source Dataset Name: Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 533
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Nitrospirae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location

• Location Name: Pennsylvania, USA
• Coordinates
  • Lat. (^o): 41.1289
  • Long. (^o): -78.4195

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026423	Metagenome / Metatranscriptome	198	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0075018_107459881	F026423	GAGG	MKPPVVLAKHVALLLMISLSVSAGCAAPLKQQLTTVGLDCSITWDKTQDQKVTGYQLTVIDRSNQAKKKVPFIPAHTTKMSCKDAGASHEGPWDVTVQSCYDQLRCGSPSEVVPFHITAK