Basic Information | |
---|---|
Taxon OID | 3300006171 Open in IMG/M |
Scaffold ID | Ga0082041_105845 Open in IMG/M |
Source Dataset Name | Saline water microbial communities from Bras del Port Salterns, Alicante, Spain ? SS19 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | GATC-Biotech AG, Konstanz, Germany |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1123 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Salt Crystallizer Ponds → Unclassified → Salt Cristalyzer Pond → Saline Water Microbial Communities From Bras Del Port Salterns, Alicante, Spain |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Alicante, Spain | |||||||
Coordinates | Lat. (o) | 38.3852246 | Long. (o) | -0.5132249 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F097996 | Metagenome | 104 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0082041_1058452 | F097996 | AGGAG | MATIKDGMHPRYLGWQVDWPVFVKMPFSANGREWKRQEHFNWAERGIDQKQVATLYATGHIYHNYELEKQNKVGDRLGELNSEQLKRLVVQLNDIVKRGTTTTKEFQDKRCKQSKLEDKQRGLIRRFLNRNQWIVEDFYEIRDYLLAED* |
⦗Top⦘ |