Scaffold Ga0082041_102494

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0082041_102494

Scaffold Ga0082041_102494

Overview

Basic Information
Taxon OID	3300006171 Open in IMG/M
Scaffold ID	Ga0082041_102494 Open in IMG/M
Source Dataset Name	Saline water microbial communities from Bras del Port Salterns, Alicante, Spain ? SS19
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	GATC-Biotech AG, Konstanz, Germany
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	1704
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Salt Crystallizer Ponds → Unclassified → Salt Cristalyzer Pond → Saline Water Microbial Communities From Bras Del Port Salterns, Alicante, Spain

Source Dataset Sampling Location
Location Name	Alicante, Spain
Coordinates	Lat. (^o)	38.3852246	Long. (^o)	-0.5132249	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056035	Metagenome / Metatranscriptome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0082041_1024942	F056035	GGCGG	MSLLYKSKEEQTTTCEIKQEGGKIVLDFYSDCGKFGTDEMLDGYKLTPERLLQILQDRDDYSEDELYPLRTTVGCICSDLN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.