| Basic Information | |
|---|---|
| Taxon OID | 3300006171 Open in IMG/M |
| Scaffold ID | Ga0082041_100571 Open in IMG/M |
| Source Dataset Name | Saline water microbial communities from Bras del Port Salterns, Alicante, Spain ? SS19 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | GATC-Biotech AG, Konstanz, Germany |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3425 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → unclassified bacterial viruses → environmental samples → uncultured marine phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Salt Crystallizer Ponds → Unclassified → Salt Cristalyzer Pond → Saline Water Microbial Communities From Bras Del Port Salterns, Alicante, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alicante, Spain | |||||||
| Coordinates | Lat. (o) | 38.3852246 | Long. (o) | -0.5132249 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F048548 | Metagenome / Metatranscriptome | 148 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0082041_1005713 | F048548 | N/A | MKNVLIVEHNTNPLNDINENKSQKQDKYVLGGSFTEFNVKNRNERVYTWKNSNQL* |
| ⦗Top⦘ |